scalpt said:Orin-
Are you on minoxidil or finasteride?
Currently coming down from dutasteride, now on finasteride. Never tried minoxidil. Doesn't seem worth the trouble or cost.
scalpt said:Orin-
Are you on minoxidil or finasteride?
[00063] In another embodiment, the inhibitor of an EGF or an EGF receptor is panirumumab. In another embodiment, the inhibitor is AG1478. In another embodiment, the inhibitor is nimotuzumab. In another embodiment, the inhibitor is an antibody that binds EGF or EGFR. In another embodiment, the inhibitor is HuMax-EGFR® (Genmab, Copenhagen, Denmark). In another embodiment, the inhibitor is cetuximab. In another embodiment, the inhibitor is IMC 11F8. In another embodiment, the inhibitor is matuzumab. In another embodiment, the inhibitor is SC 100. In another embodiment, the inhibitor is ALT 110. In another embodiment, the inhibitor is PX 1032. In another embodiment, the inhibitor is BMS 599626. In another embodiment, the inhibitor is MDX 214. In another embodiment, the inhibitor is PX 1041. In another embodiment, the inhibitor is any other inhibitor of an EGF or an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
[00064] In another embodiment, the compound or factor that promotes a differentiation of an uncommitted epidermal cell into a HF cell is an inhibitor of a tyrosine kinase activity of an EGF receptor. In another embodiment, the inhibitor is gefitinib. In another embodiment, the inhibitor is
P-7628-PC erlotinib. In another embodiment, the inhibitor is canertinib. In another embodiment, the inhibitor is leflunomide. In another embodiment, the inhibitor is A77 1726. In another embodiment, the inhibitor is pelitinib. In another embodiment, the inhibitor is ZD 1839. In another embodiment, the inhibitor is CL 3877S5. In another embodiment, the inhibitor is EKI 785. In another embodiment, the inhibitor is vandetanib. In another embodiment., the inhibitor is any other inhibitor of a tyrosine kinase activity of an EGF receptor known in the art. Each possibility represents a separate embodiment of the present invention.
michael barry said:Here is the entire patent, http://www.wipo.int/pctdb/en/wo.jsp?wo= ... SPLAY=DESC . If you read through it, although it might take a good hour, you will understand what they are up to. Note----------patents dont stay online forever in all cases.
Michael, what's the deal with all the gibberish through the mid-section of the patent?Follica Patent said:ITSHLGQPSPKQQPLEPGEAAL HSDSQDGHQMALLNFFFPDEK-PYSEEESRRVimNKRSKSNEGADGPVKNKKICGKKAGPP GPNGPPGPPGPPGPQGPPGIPGIPGIPGTTVMGPPGPPGPPGPQGPPGLQGPSGAADKAGTR ENQPAWHLQGQGSAIQVKNDLSGGVLNDWSRITMNPKVFKLHPRSGELEVLVDGTYFIY
Mr. Barry, you have said before that you think Follica only will work at the donor area. Why do you think Follica wont grow hair at the crown, top of the head and in front? Is the skin to thin? And btw, do you know about another forum with new research threads? I see hairsite HM forum is just a real nuthouse.
eAlso I would like to know if a dermoabrasion can kill current follicles. I know that some people performs laser therapy to kill hair, but this laser is not the same than dermoabrasion, because they configure it to try to reach only Hair follicle. Would not like to en with a Pink bald spot in my hairlin